General Information

  • ID:  hor004163
  • Uniprot ID:  Q99ML8
  • Protein name:  Urocortin-2
  • Gene name:  UCN2
  • Organism:  Mus musculus (Mouse)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  hypothalamus brainstem olfactory bulb and pituitary
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0042562 hormone binding; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007586 digestion; GO:0009755 hormone-mediated signaling pathway; GO:0010629 negative regulation of gene expression; GO:0031669 cellular response to nutrient levels; GO:0033685 negative regulation of luteinizing hormone secretion; GO:0046882 negative regulation of follicle-stimulating hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV
  • Length:  38(73-110)
  • Propeptide:  MMTRWALVVFVVLMLDRILFVPGTPIPTFQLLPQNSLETTPSSVTSESSSGTTTGPSASWSNSKASPYLDTRVILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVGRR
  • Signal peptide:  MMTRWALVVFVVLMLDRILFVPG
  • Modification:  T38 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Suppresses food intake, delays gastric emptying and decreases heat-induced edema; might represent an endogenous ligand for maintaining homeostasis after stress
  • Mechanism:  Autocrine/paracrine and pharmacologic effects to activate AMP-activated protein kinase in the heart.
  • Cross BBB:  YES
  • Target:  Crhr2, Crhr1
  • Target Unid:  Q60748, P35347
  • IC50: NA
  • EC50: cAMP rCRF-R2-alpha:0.073nmol;cAMP mCRF-R2-beta:0.081nmol
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99ML8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004163_AF2.pdbhor004163_ESM.pdb

Physical Information

Mass: 481413 Formula: C187H319N55O51
Absent amino acids: CFMW Common amino acids: AL
pI: 10.44 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 21
Hydrophobicity: 52.37 Boman Index: -2666
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 154.21
Instability Index: 3323.68 Extinction Coefficient cystines: 1490
Absorbance 280nm: 40.27

Literature

  • PubMed ID:  12764078
  • Title:  Glucocorticoids Regulate the Expression of the Mouse Urocortin II Gene: A Putative Connection Between the Corticotropin-Releasing Factor Receptor Pathways